[Trp4] - beta - Amyloid (1 - 40)
[Trp4] - beta - Amyloid (1 - 40)
Sequence (1LC):
DAEWRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence (3LC):
NH2 - Asp - Ala - Glu - Trp - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - COOH
Price/Unit:
$2,286
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This is amino acid 1 to 40 fragment of beta-amyloid peptide with phenylalanine at position 4 substituted with tryptophan.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
No Product Found