(T1BT*) - linear
Sequence (1LC):
DPNANPNVDPNANPNVNANPNANPNANPEYLNKIQNSLSTEWSPCSVT
Sequence (3LC):
NH2 - Asp - Pro - Asn - Ala - Asn - Pro - Asn - Val - Asp - Pro - Asn - Ala - Asn - Pro - Asn - Val - Asn - Ala - Asn - Pro - Asn - Ala - Asn - Pro - Asn - Ala - Asn - Pro - Glu - Tyr - Leu - Asn - Lys - Ile - Gln - Asn - Ser - Leu - Ser - Thr - Glu - Trp - Ser - Pro - Cys - Ser - Val - Thr - COOH
Price/Unit:
$1,229
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
The synthetic peptide vaccine, (T1BT*)-linear is comprised of a 48-mer peptide containing T and B cell epitopes of the malaria CS protein.The (DPNANPNV)2 sequence representes the T1 epitope, located in the minor repeat region of the P. falciparum CS protein, and the (NANP)3 sequence representes the B cell epitope located in the major repeat region. The T* sequence, EYLNKIQNSLSTEWSPCSVT, representing aa 326–345 of the P. falciparum CS NF54 isolate.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
Nardin, E.H. et al. J. Immunol. 166, 481 (2001)