Secretin, human, FAM - and biotin - labeled
Secretin, human, FAM - and biotin - labeled
Sequence (1LC):
FAM-HSDGTFTSELSRLREGARLQRLLQGLVK(Biotin)
Sequence (3LC):
FAM - His - Ser - Asp - Gly - Thr - Phe - Thr - Ser - Glu - Leu - Ser - Arg - Leu - Arg - Glu - Gly - Ala - Arg - Leu - Gln - Arg - Leu - Leu - Gln - Gly - Leu - Val - Lys(Biotin) - OH
Price/Unit:
$1,755
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Lyophilized solid, trifluoroacetate (TFA) salt format
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
No Product Found