Scrambled - beta - Amyloid (1 - 42), Human (10130-005)
Scrambled - beta - Amyloid (1 - 42), Human (10130-005)
Sequence (1LC):
AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Sequence (3LC):
H - Ala - Ile - Ala - Glu - Gly - Asp - Ser - His - Val - Leu - Lys - Glu - Gly - Ala - Tyr - Met - Glu - Ile - Phe - Asp - Val - Gln - Gly - His - Val - Phe - Gly - Gly - Lys - Ile - Phe - Arg - Val - Val - Asp - Leu - Gly - Ser - His - Asn - Val - Ala - OH
Price/Unit:
$878
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Lyophilized solid, trifluoroacetate (TFA) salt format
Storage:
Upon receipt, store lyophilized peptide at -20°C or lower. Reconstituted peptide can be aliquoted and stored at -20 °C or lower.
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
No Product Found