RSK3, Ribosomal S6 Kinase 3
RSK3, Ribosomal S6 Kinase 3
Sequence (1LC):
ALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL
Sequence (3LC):
H - Ala - Leu - Asn - Arg - Thr - Pro - Gln - Ala - Pro - Arg - Leu - Glu - Pro - Val - Leu - Ser - Ser - Asn - Leu - Ala - Gln - Arg - Arg - Gly - Met - Lys - Arg - Leu - Thr - Ser - Thr - Arg - Leu - OH
Price/Unit:
$1,283
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Lyophilized solid, trifluoroacetate (TFA) salt format
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
Roux, P. and J. Blenis Microbiol. Mol. Biol. Rev. 68, 320 (2004); Roux, P. et al. Mol. Cell. Biol. 23, 4796 (2003); C. Hauge and M. Frödin Cell Sci. 119, 3021 (2006).
No Product Found