Pramlintide, Acetate [Pro25, 28, 29] - Amylin(1 - 37), human, Amide
Pramlintide, Acetate [Pro25, 28, 29] - Amylin(1 - 37), human, Amide
Sequence (1LC):
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-CONH2 (S-S Bond) acetate salt
Sequence (3LC):
NH2 - Lys - Cys - Asn - Thr - Ala - Thr - Cys - Ala - Thr - Gln - Arg - Leu - Ala - Asn - Phe - Leu - Val - His - Ser - Ser - Asn - Asn - Phe - Gly - Pro - Ile - Leu - Pro - Pro - Thr - Asn - Val - Gly - Ser - Asn - Thr - Tyr - CONH2 acetate salt (S - S Bond)
Price/Unit:
$896
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
- McQueen, J. Am. J. Health-System Pharmacy 62 2363 (2005).
No Product Found