Neuropeptide K, porcine
Sequence (1LC):
DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-CONH2
Sequence (3LC):
H - Asp - Ala - Asp - Ser - Ser - Ile - Glu - Lys - Gln - Val - Ala - Leu - Leu - Lys - Ala - Leu - Tyr - Gly - His - Gly - Gln - Ile - Ser - His - Lys - Arg - His - Lys - Thr - Asp - Ser - Phe - Val - Gly - Leu - Met - CONH2
Price/Unit:
$1,268
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
Ref: Boks, GJ. Structure and conformational behaviour of peptoid peptidomimetics (1997).