Mitogen- and Stress-Activated Kinase2 (MSK2), D-do
Mitogen- and Stress-Activated Kinase2 (MSK2), D-do
Sequence (1LC):
FNRGKREGFFLKSVENAPLAKRRKQKLRSATAS
Sequence (3LC):
H - Phe - Asn - Arg - Gly - Lys - Arg - Glu - Gly - Phe - Phe - Leu - Lys - Ser - Val - Glu - Asn - Ala - Pro - Leu - Ala - Lys - Arg - Arg - Lys - Gln - Lys - Leu - Arg - Ser - Ala - Thr - Ala - Ser - OH
Price/Unit:
$1,283
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Lyophilized solid, trifluoroacetate (TFA) salt format
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
Roux, P. and J. Blenis Microbiol. Mol. Biol. Rev. 68, 320 (2004).
No Product Found