Mitogen - and Stress - Activated Kinase1 (MSK1), D - domain, Fragment 1
Mitogen - and Stress - Activated Kinase1 (MSK1), D - domain, Fragment 1
Sequence (1LC):
FNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTE
Sequence (3LC):
H - Phe - Asn - Lys - Tyr - Lys - Arg - Glu - Gly - Phe - Cys - Leu - Gln - Asn - Val - Asp - Lys - Ala - Pro - Leu - Ala - Lys - Arg - Arg - Lys - Met - Lys - Lys - Thr - Ser - Thr - Ser - Thr - Glu - OH
Price/Unit:
$1,283
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Lyophilized solid, trifluoroacetate (TFA) salt format
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
Roux, P. and J. Blenis Microbiol. Mol. Biol. Rev. 68, 320 (2004).
No Product Found