[Leu33] - beta - Amyloid (1 - 40)
[Leu33] - beta - Amyloid (1 - 40)
Sequence (1LC):
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIILLMVGGVV
Sequence (3LC):
NH2 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Leu - Leu - Met - Val - Gly - Gly - Val - Val - COOH
Price/Unit:
$653
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This is amino acids 1 to 40 beta amyloid peptide with the substitution of Gly33 to Leu33. This peptide was used in conformational studies associated with Alzheimers diseases. Large and hydrophobic leucine side chain would effectively eliminate the surface groove created by Gly33. This mutant peptide forms aggregates. There is no indication of either protofibril or fibril formation.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
- Sato, T. et al. Biochem.45, 5509 (2006);
- Kim, S. et al. PNAS102, 14278 (2005).
No Product Found