Human Parvovirus B19 (61 - 94)
Human Parvovirus B19 (61 - 94)
Sequence (1LC):
TKDIDNVEFKYLTRYEQHVIRMLRLCNMYQNLEK
Sequence (3LC):
NH2 - Thr - Lys - Asp - Ile - Asp - Asn - Val - Glu - Phe - Lys - Tyr - Leu - Thr - Arg - Tyr - Glu - Gln - His - Val - Ile - Arg - Met - Leu - Arg - Leu - Cys - Asn - Met - Tyr - Gln - Asn - Leu - Glu - Lys - COOH
Price/Unit:
$1,247
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This sequence is amino acids 61 to 94 fragment of Human Parvovirus B19 (also designated Erythrovirus B19), a member of the family Parvoviridae capable of infection human erythrocytes. Parvovirus is also commonly found to cause erythema infectiosum in children and exhibits varying degrees of infection depending on the immunologic and hematologic status of the host.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
Heegaard, E. et al. J Virol 58, 921 (1986).
No Product Found