Glucagon - Like Peptide 1, (GLP - 1) amide, human
Glucagon - Like Peptide 1, (GLP - 1) amide, human
Sequence (1LC):
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-CONH2
Sequence (3LC):
H - His - Asp - Glu - Phe - Glu - Arg - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - CONH2
Price/Unit:
$1,436
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
Ref: Drucker, D. et al. Proc. Natl. Acad. Sci. USA 84, 3434 (1987); Kieffer, T. and J. Habener, Endo. Rev. 20, 876 (1999).
No Product Found