[Gln3] - beta - Amyloid (3 - 40); E3Q beta - Amyloid (3 - 40)
[Gln3] - beta - Amyloid (3 - 40); E3Q beta - Amyloid (3 - 40)
Sequence (1LC):
QFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence (3LC):
NH2 - Gln - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - COOH
Price/Unit:
$1,268
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This peptide is derived from beta-amyloid (3-40) with substitution of Glu3 to Gln. This mutation is used to study the binding of copper (CuII) to Aβ. Copper, along with Aβ, is often found in Alzheimer’s disease (AD) plaques.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
- Karr, JW. and VA. Szalai J Am Chem Soc 129, 3796 (2007).
No Product Found