Gamma Interferon (95 - 132), IFN - g (95 - 132), mouse
Gamma Interferon (95 - 132), IFN - g (95 - 132), mouse
Sequence (1LC):
AKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSR
Sequence (3LC):
NH2 - Ala - Lys - Phe - Glu - Val - Asn - Asn - Pro - Gln - Val - Gln - Arg - Gln - Ala - Phe - Asn - Glu - Leu - Ile - Arg - Val - Val - His - Gln - Leu - Leu - Pro - Glu - Ser - Ser - Leu - Arg - Lys - Arg - Lys - Arg - Ser - Arg - COOH
Price/Unit:
$1,688
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This peptide is murine interferon (IFN)-g (95-132). This peptide has been shown to bind the IFNGR1 receptor subunit and activate signal transducer and activator of transcription (STAT)-1a. This peptide has antiviral effects on fibroblasts and keratinocytes infected with herpes simplex virus (HSV)-1. It also has antiviral effects against the vaccinia virus, encephalomyocarditis virus, and vesicular stomatitis virus.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
1. Frey, K. et al. J Immunol 183, 1253 (2009);
2. Ahmed, C. et al. J Immunol 178, 4576 (2007).
No Product Found