Gamma Interferon (95 - 125), IFN - γ (95 - 125), mouse
Gamma Interferon (95 - 125), IFN - γ (95 - 125), mouse
Sequence (1LC):
AKFEVNNPQVQRQAFNELIRVVHQLLPESSL
Sequence (3LC):
NH2 - Ala - Lys - Phe - Glu - Val - Asn - Asn - Pro - Gln - Val - Gln - Arg - Gln - Ala - Phe - Asn - Glu - Leu - Ile - Arg - Val - Val - His - Gln - Leu - Leu - Pro - Glu - Ser - Ser - Leu - COOH
Price/Unit:
$1,119
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This peptide is murine interferon (IFN)-γ (95-125). This peptide can be used as a negative control to IFN-γ (95-132), which has been shown to have antiviral effects against the herpes simplex virus, vaccinia virus, encephalomyocarditis virus, and vesicular stomatitis virus. This peptide lacks the nuclear localization sequence required for antiviral activity.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
1. Frey, K. et al. J Immunol 183, 1253 (2009);
2. Ahmed, C. et al. J Immunol 178, 4576 (2007);
3. Otero, M. et al. Arthritis Res Ther7, 581 (2005).
No Product Found