Galanin Message Associated Peptide, GMAP (1 - 41),
Galanin Message Associated Peptide, GMAP (1 - 41),
Sequence (1LC):
ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGAL-CONH2
Sequence (3LC):
H - Glu - Leu - Glu - Pro - Glu - Asp - Glu - Ala - Arg - Pro - Gly - Gly - Phe - Asp - Arg - Leu - Gln - Ser - Glu - Asp - Lys - Ala - Ile - Arg - Thr - Ile - Met - Glu - Phe - Leu - Ala - Phe - Leu - His - Leu - Lys - Glu - Ala - Gly - Ala - Leu - CONH2
Price/Unit:
$1,605
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
Ref: Rokaeus, A. and MJ. Brownstein, Proc. Natl. Acad. Sci. USA 83, 6287 (1986); Xu, Z. et al. J. Comp. Neurol. 392, 227 (1998); Xu, Z. et al. Proc. Natl. Acad. Sci. USA 93, 14901 (1996).
No Product Found