Galanin Like Peptide (GALP); rat
Galanin Like Peptide (GALP); rat
Sequence (1LC):
APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT
Sequence (3LC):
H - Ala - Pro - Ala - His - Arg - Gly - Arg - Gly - Gly - Trp - Thr - Leu - Asn - Ser - Ala - Gly - Tyr - Leu - Leu - Gly - Pro - Val - Leu - His - Leu - Ser - Ser - Lys - Ala - Asn - Gln - Gly - Arg - Lys - Thr - Asp - Ser - Ala - Leu - Glu - Ile - Leu - Asp - Leu - Trp - Lys - Ala - Ile - Asp - Gly - Leu - Pro - Tyr - Ser - Arg - Ser - Pro - Arg - Met - Thr - OH
Price/Unit:
$1,283
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Lyophilized solid, trifluoroacetate (TFA) salt format
Storage:
Upon receipt, store lyophilized peptide at -20°C or lower. Reconstituted peptide can be aliquoted and stored at -20 °C or lower.
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
Stoyanovitch, A. et al. Diabetes 54, 2471 (2005); Ohtaki, T. et al. J. Biol. Chem. 274, 37041 (1999).
No Product Found