Chlorotoxin (Cltx)
Sequence (1LC):
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-CONH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
Sequence (3LC):
H - Met - Cys - Met - Pro - Cys - Phe - Thr - Thr - Asp - His - Gln - Met - Ala - Arg - Lys - Cys - Asp - Asp - Cys - Cys - Gly - Gly - Lys - Gly - Arg - Gly - Lys - Cys - Tyr - Gly - Pro - Gln - Cys - Leu - Cys - Arg - CONH2 (Disulfide bridge: 2 - 19,5 - 28,16 - 33,20 - 35)
Price/Unit:
$3,882
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
Ref: DeBin, JA. and GR. Strichartz, Toxicon 29, 1403 (1991); DeBin, JA. et al. Am. J. Physiol. 264, C361 (1993).