Cerebral peptide 2
Sequence (1LC):
FDFGFAGLDTYDAIHRALEQPARGTSNSGSGYNMLMKMQRH-CONH2
Sequence (3LC):
H - Phe - Asp - Phe - Gly - Phe - Ala - Gly - Leu - Asp - Thr - Tyr - Asp - Ala - Ile - His - Arg - Ala - Leu - Glu - Gln - Pro - Ala - Arg - Gly - Thr - Ser - Asn - Ser - Gly - Ser - Gly - Tyr - Asn - Met - Leu - Met - Lys - Met - Gln - Arg - His - CONH2
Price/Unit:
$1,688
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
Ref: Phares, G. and PJ. Lloyd, Neurosci. 16, 7841 (1996); Biochem. 35, 5921 (1996).