Contact Us
800.227.0627

C39 Peptide; Human Respiratory Syncytial Virus (hRSV) F Protein (482 - 520)

C39 Peptide; Human Respiratory Syncytial Virus (hRSV) F Protein (482 - 520)
Sequence (1LC):
VFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGK
Sequence (3LC):
NH2 - Val - Phe - Pro - Ser - Asp - Glu - Phe - Asp - Ala - Ser - Ile - Ser - Gln - Val - Asn - Glu - Lys - Ile - Asn - Gln - Ser - Leu - Ala - Phe - Ile - Arg - Lys - Ser - Asp - Glu - Leu - Leu - His - Asn - Val - Asn - Ala - Gly - Lys - COOH
Catalog :
14022-01
Price/Unit:
$1,808  (For other quantities please Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Purity:
>95%
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This peptide is amino acids 482 to 520 fragment of human Respiratory Syncytial Virus (hRSV) F protein, located within the C-terminal region of the F1 subunit, also known as heptad repeat C (HR-C). This peptide forms the outer anti-parallel portion of an ?-helical trimer of heterodimers, which resembles a coiled-coil configuration, and facilitates membrane fusion during infection by placing the cell and viral membranes in proximity while undergoing a conformational change.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
M.W.:
4361.8 g/mol
Reference/Citations:
Zhao, X. et al. Proc Natl Acad Sci USA 97, 14172 (2000).