C34 - LC - Biotin, gp41 HIV fragment
C34 - LC - Biotin, gp41 HIV fragment
Sequence (1LC):
WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLK(LC-Biotin)
Sequence (3LC):
H - Trp - Met - Glu - Trp - Asp - Arg - Glu - Ile - Asn - Asn - Tyr - Thr - Ser - Leu - Ile - His - Ser - Leu - Ile - Glu - Glu - Ser - Gln - Asn - Gln - Gln - Glu - Lys - Asn - Glu - Gln - Glu - Leu - Leu - Lys(LC - BIOTIN) - NH2
Price/Unit:
$1,098
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Lyophilized solid, trifluoroacetate (TFA) salt format
Description:
This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide act as an inhibitors against HIV, respiratory syncytial virus (RSV), human parainfluenza virus (HPV) and also exhibit antifusogenic properties.
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
No Product Found