β - CGRP, human
Sequence (1LC):
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
Sequence (3LC):
NH2 - Ala - Cys - Asn - Thr - Ala - Thr - Cys - Val - Thr - His - Arg - Leu - Ala - Gly - Leu - Leu - Ser - Arg - Ser - Gly - Gly - Met - Val - Lys - Ser - Asn - Phe - Val - Pro - Thr - Asn - Val - Gly - Ser - Lys - Ala - Phe - CONH2 (Disulfide bridge:2 - 7)
Price/Unit:
$1,452
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This 37-amino acid peptide is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular and nervous systems. β-CGRP contains a disulphide bridge at the N-terminus, a C-terminal phenylalanine amide important for immune recognition, and an a-helix between residues 8 and 18.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
Bose, C. et al. Biochem J 280, 147 (1991).