Beta - Amyloid (9 - 42) - Lys(Biotin) - NH2
Beta - Amyloid (9 - 42) - Lys(Biotin) - NH2
Sequence (1LC):
GYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-CONH2
Sequence (3LC):
NH2 - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - Lys(Biotin) - CONH2
Price/Unit:
$1,322
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
No Product Found