Beta - Amyloid (8 - 40), scrambled
Beta - Amyloid (8 - 40), scrambled
Sequence (1LC):
EYVHGKQHSGMVDGIVFFEGVLSVAKIGVGNAL
Sequence (3LC):
NH2 - Glu - Tyr - Val - His - Gly - Lys - Gln - His - Ser - Gly - Met - Val - Asp - Gly - Ile - Val - Phe - Phe - Glu - Gly - Val - Leu - Ser - Val - Ala - Lys - Ile - Gly - Val - Gly - Asn - Ala - Leu - COOH
Price/Unit:
$1,193
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This is a scrambled β-Amyloid amino acids 8 to 40 peptide.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
No Product Found