β-Amyloid (42 - 1), Human
β-Amyloid (42 - 1), Human
Sequence (1LC):
AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Sequence (3LC):
H - Ala - Ile - Val - Val - Gly - Gly - Val - Met - Leu - Gly - Ile - Ile - Ala - Gly - Lys - Asn - Ser - Gly - Val - Asp - Glu - Ala - Phe - Phe - Val - Leu - Lys - Gln - His - His - Val - Glu - Tyr - Gly - Ser - Asp - His - Arg - Phe - Glu - Ala - Asp - OH
Price/Unit:
$375
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Lyophilized solid, trifluoroacetate (TFA) salt format
Storage:
Upon receipt, store lyophilized peptide at -20°C or lower. Reconstituted peptide can be aliquoted and stored at -20 °C or lower.
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
No Product Found