Beta - Amyloid (11 - 42), human
Beta - Amyloid (11 - 42), human
Sequence (1LC):
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence (3LC):
NH2 - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - COOH
Price/Unit:
$1,013
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This is amino acids 11 to 42 fragment of beta-amyloid. This peptide was detected in Alzheimer disease brains within several principal beta-amyloid variants.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
- Näslund, J. et al. PNAS USA 91, 8378 (1994).
No Product Found