Beta - Amyloid (1 - 45), mouse, rat
Beta - Amyloid (1 - 45), mouse, rat
Sequence (1LC):
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVI
Sequence (3LC):
NH2 - Asp - Ala - Glu - Phe - Gly - His - Asp - Ser - Gly - Phe - Glu - Val - Arg - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - Thr - Val - Ile - COOH
Price/Unit:
$822
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This is amino acids 1 to 45 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
No Product Found