Beta - Amyloid (1 - 40) (S26C) Dimer
Beta - Amyloid (1 - 40) (S26C) Dimer
Sequence (1LC):
DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV (dimer)
Sequence (3LC):
NH2 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Cys - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - COOH (dimer)
Price/Unit:
$1,767
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This is dimerization of S26C beta-Amyloid (1-40) peptide.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
No Product Found