Beta - Amyloid (1 - 40) • HCl, Human
Beta - Amyloid (1 - 40) • HCl, Human
Sequence (1LC):
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV• HCl
Sequence (3LC):
NH2 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - COOH• HCl
Price/Unit:
$980
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain, followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region. The 40-residues beta-APP peptide implcated in the pathogenesis of Alzheimer's disease (AD) and aged Down's Syndrome, which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21.
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Formula:
C194H295N53O58S1
Reference/Citations:
- Richardson JS, et al. Ann N Y Acad Sci. 777:362-367 (1996)
- McLaurin J, Chakrabartty A. Eur J Biochem. 245(2):355-363 (1997)
- Hoglund K, et al. Arch Neurol. 61(3):333-337 (2004)
No Product Found