β-Amyloid (1 - 39)
Sequence (1LC):
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Sequence (3LC):
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - OH
Price/Unit:
$1,115
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
Ref; Jarrett, JT. et al. Biochem. 32, 4693 (1993); Giacomelli, CE. and W. Norde, Macromol. Biosci. 5, 401 (2005).