[Asp37] - beta - Amyloid (1 - 42)
[Asp37] - beta - Amyloid (1 - 42)
Sequence (1LC):
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVDGVVIA
Sequence (3LC):
NH2 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Asp - Gly - Val - Val - Ile - Ala - COOH
Price/Unit:
$1,322
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This is beta-amyloid peptide amino acids 1 to 42 where Gly37 is replaced by the negatively charged Asp. This substitution completely abolishes neurotoxic and oxidative processes associated with the parent peptide, resulting in the lack of cell toxicity and protein oxidation in contrast to those observed in the native beta-amyloid 1 to 42. G37D peptide does not display the aggregation properties that are associated with native beta-amyloid.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
- Butterfield, DA. Free Rad. Res. 36, 1307 (2002);
- Kanski, J. et al. Neurotox. Res. 4, 219 (2002).
No Product Found