[Asn23] - β- Amyloid (1 - 40), (D23N), Iowa Mutation (10275-005)
[Asn23] - β- Amyloid (1 - 40), (D23N), Iowa Mutation (10275-005)
Sequence (1LC):
DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Sequence (3LC):
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asn - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
Price/Unit:
$728
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
Amyloid ?-protein (1-40) has demonstrated with both neurotrophic and neurotoxic effects on the neuronal age and the concentration of the ?-protein. The amyloid ?-protein (1-40) has been used as well as the amyloid ?-protein (1-42) to detect amyloid ?-protein multimers in the cerebrospinal fluid of Alzheimer's disease patients.
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
- G.Bitan et al., Proc. Natl. Acad. Sci. USA , 100, 330 (2003)
- M.Pitschke et al., Nature Med. 4, 832 (1998)
- B.A.Yankner et al., Science , 250, 279 (1990)
- M.A.Kowalska and K.Badellino, Biochem. Biophys. Res. Commun. , 205, 1829 (1994)
- A.Klegeris et al.,
No Product Found