[Arg13] - beta - Amyloid (1 - 42); H13R beta - Amyloid (1 - 42)
[Arg13] - beta - Amyloid (1 - 42); H13R beta - Amyloid (1 - 42)
Sequence (1LC):
DAEFRHDSGYEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence (3LC):
NH2 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - Arg - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - COOH
Price/Unit:
$1,638
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This peptide is beta-amyloid (1-42) with substitution of His13 to Arg. Histidine residues have been implicated in interactions between copper and Aβ. This peptide can be used to study the role copper plays in aggregation of Aβ and Alzheimer’s disease (AD) pathogenesis.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
- Dai, X. et al. J Mol Neurosci 41, 66 (2010).
No Product Found