Amyloid Precursor Protein (APP) (741 - 770)
Amyloid Precursor Protein (APP) (741 - 770)
Sequence (1LC):
AVTPEERHLSKMQQNGYENPTYKFFEQMQN
Sequence (3LC):
NH2 - Ala - Val - Thr - Pro - Glu - Glu - Arg - His - Leu - Ser - Lys - Met - Gln - Gln - Asn - Gly - Tyr - Glu - Asn - Pro - Thr - Tyr - Lys - Phe - Phe - Glu - Gln - Met - Gln - Asn - COOH
Price/Unit:
$1,287
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This is amino acids 741 to 770 fragment of the Amyloid Precursor Protein (APP).
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
No Product Found