Amylin (8 - 37), rat
Sequence (1LC):
ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-CONH2
Sequence (3LC):
H - Ala - Thr - Gln - Arg - Leu - Ala - Asn - Phe - Leu - Val - Arg - Ser - Ser - Asn - Asn - Leu - Gly - Pro - Val - Leu - Pro - Pro - Thr - Asn - Val - Gly - Ser - Asn - Thr - Tyr - CONH2
Price/Unit:
$810
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
Amylin (8-37) peptide selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle. Study showed it increases whole-body and muscle insulin sensitivity and consistently reduces basal insulin levels in normal and hGH-induced insulin-resistant in rats.
C-terminus is amidated.
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
- R.O.Deems et al., Biochem. Biophys. Res. Commun. , 181, 116 (1991)
- Hettiarachchi, M. et al. Am. J. Physiol. Endocrinol. Metab. 273, E859 (1997)
- F.L.Piao et al., Regul. Peptides , 117, 159 (2004)