Amylin (1 - 37), rat, mouse
Amylin (1 - 37), rat, mouse
Sequence (1LC):
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-CONH2 (Disulfide bridge: Cys2-Cys7)
Sequence (3LC):
H - Lys - Cys - Asn - Thr - Ala - Thr - Cys - Ala - Thr - Gln - Arg - Leu - Ala - Asn - Phe - Leu - Val - Arg - Ser - Ser - Asn - Asn - Leu - Gly - Pro - Val - Leu - Pro - Pro - Thr - Asn - Val - Gly - Ser - Asn - Thr - Tyr - CONH2 (Disulfide bridge: Cys2 - Cys7)
Price/Unit:
$1,601
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
Also called Islet or insulinoma amyloid polypeptide (IAPP), this rat amylin differs from human amylin in that it lacks a fibril-forming capacity. As a consequence, toxic effects have been reported for human but not for rat amylin. This peptide have disulfide bond at position 2 and 7 of the cys with c-terminal amidated.
C-terminus is amidated.
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Formula:
C167H272N52O53S2
Reference/Citations:
- H.A.Golpon et al., Peptides , 24, 1157
- J.D.Leffert et al., Proc. Natl. Acad. Sci. USA , 86, 3127 (1989)
- J.Green et al., J. Mol. Biol. , 326, 1147 (2003)
- Green JD, et al. J.Biol.Chem. 279(13): 12206-12212 (2004)
- Kairamkonda V, et al. 90(12): 1279-1282 (2005)
- Stadler M, et al. Diabetes Care. 29(5): 1031-1038 (2006)
No Product Found