[Ala25] - beta - Amyloid (1 - 42); G25A beta - Amyloid (1 - 42)
[Ala25] - beta - Amyloid (1 - 42); G25A beta - Amyloid (1 - 42)
Sequence (1LC):
DAEFRHDSGYEVHHQKLVFFAEDVASNKGAIIGLMVGGVVIA
Sequence (3LC):
NH2 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Ala - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - COOH
Price/Unit:
$1,638
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This peptide is beta-amyloid (1-42) with a single residue Ala mutation at Gly25. Substitution of Gly25 to Ala has been shown to reduce Ab42 levels while having no effect on Ab40. Position 25 of this peptide may be a part of a GxxxG dimerization motif.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
- Munter, LM et al. EMBO J 26, 1702 (2007).
No Product Found