[Ala23] - beta - Amyloid (1 - 42); D23A beta - Amyloid (1 - 42)
[Ala23] - beta - Amyloid (1 - 42); D23A beta - Amyloid (1 - 42)
Sequence (1LC):
DAEFRHDSGYEVHHQKLVFFAEAVGSNKGAIIGLMVGGVVIA
Sequence (3LC):
NH2 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Ala - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - COOH
Price/Unit:
$1,638
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This peptide is derived from beta-amyloid (1-42) with substitution of Asp23 to Ala. This peptide is used to study the contribution of the Asp23-Lys28 interpeptide salt bridge to the structure of amyloid fibrils.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
- Lemkul, J. and DR. Bevan J Phys Chem B 114, 1652 (2010).
No Product Found