[Ala18] - beta - Amyloid (1 - 42); V18A beta - Amyloid (1 - 42)
[Ala18] - beta - Amyloid (1 - 42); V18A beta - Amyloid (1 - 42)
Sequence (1LC):
DAEFRHDSGYEVHHQKLAFFAEDVGSNKGAIIGLMVGGVVIA
Sequence (3LC):
NH2 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Ala - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - COOH
Price/Unit:
$1,638
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This peptide is beta-amyloid (1-42) with substitution of Val18 to Ala. This alanine mutation reduces formation of amyloid fibrils. Amyloid fibrils are implicated in many diseases, such as Alzheimer’s, Parkinson’s, type II diabetes, and transmissible spongiform encephalopathies.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Reference/Citations:
- Tjenberg, L. et al. J Biol Chem 277, 43243 (2002).
No Product Found