AGRP fragment (83 - 132), amide
AGRP fragment (83 - 132), amide
Sequence (1LC):
SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-CONH2 (5 disulfide bridges)
Sequence (3LC):
NH2 - Ser - Ser - Arg - Arg - Cys - Val - Arg - Leu - His - Glu - Ser - Cys - Leu - Gly - Gln - Gln - Val - Pro - Cys - Cys - Asp - Pro - Cys - Ala - Thr - Cys - Tyr - Cys - Arg - Phe - Phe - Asn - Ala - Phe - Cys - Tyr - Cys - Arg - Lys - Leu - Gly - Thr - Ala - Met - Asn - Pro - Cys - Ser - Arg - Thr - CONH2 (5 disulfide bridges; 87 - 102, 94 - 108, 101 - 119, 105 - 129 and 110 - 117).
Price/Unit:
$2,025
(For other quantities please
Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This 5 disulfide bridged peptide is a known endogenous MC3R and MC4R antagonist. This is a powerful orexigenic peptide when infused centrally. It increases cortisol release and inhibits pulsatile LH release in monkey. AGRP, like NPY, may mediate the effect of a negative energy balance on the reproductive system by suppressing the GnRH pulse generator. AgRP (83-132) significantly increases prolactin mRNA expression level and prolactin accumulation.
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Recommended Use:
For Research Use Only!
No Product Found