800.227.0627

Pancreatic Polypeptides Products

ALL

αβδγ

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

Product Name	Catalog #	Unit	Price/Unit
BDC2.5 Mimotope RTRPLWVRME	14816-01	1 mg	$405
IGRP Catalytic Subunit - related Protein (206 - 214) VYLKTNVFL	14817-01	1 mg	$405
Insulin β Chain Peptide (15 - 23) LYLVCGERG	14818-01	1 mg	$405
Pancreatic Polypeptide human APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-CONH2	12811-01	1 mg	$710
Pancreatic Polypeptide human APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY - NH2	12811-005	0.5 mg	$392